PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G073000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MIKC_MADS
Protein Properties Length: 289aa    MW: 32592.6 Da    PI: 9.5741
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G073000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.51.3e-3164114151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                         krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Seita.3G073000.1.p  64 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 114
                         79***********************************************95 PP

2K-box97.61.9e-321342295100
               K-box   5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                         s    ++e + ++++qe+a+L+++i nLq+++R l+G+++ ++s+k+L+qLe +L+k+l kiR++Kne+l++++e++q++e elq++n +L
  Seita.3G073000.1.p 134 SA-GtVAEVTIQHYKQESARLRQQITNLQNSNRTLIGDSIATMSHKDLKQLEARLDKGLVKIRARKNEVLCSELEYMQRREMELQNDNLYL 223
                         22.2589999********************************************************************************* PP

               K-box  95 rkklee 100
                         r++++e
  Seita.3G073000.1.p 224 RSRVDE 229
                         *99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-4056115IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.22156116IPR002100Transcription factor, MADS-box
CDDcd002651.24E-4557130No hitNo description
SuperFamilySSF554553.14E-3357129IPR002100Transcription factor, MADS-box
PROSITE patternPS00350058112IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-335878IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2665112IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-337893IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-3393114IPR002100Transcription factor, MADS-box
PfamPF014862.5E-24143227IPR002487Transcription factor, K-box
PROSITE profilePS5129713.884143233IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MHIQEEQATP STDIMWGFSG QSTLTSTTGL KLKEPAPAVS SPGSGSVGAA AASEKNGRGK  60
IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL IVFSSRGRLY EYSNNSVKAT  120
IERYKKTTSD NSNSAGTVAE VTIQHYKQES ARLRQQITNL QNSNRTLIGD SIATMSHKDL  180
KQLEARLDKG LVKIRARKNE VLCSELEYMQ RREMELQNDN LYLRSRVDEN ERAQQTVNMM  240
GAPSTSEYQQ GFIPYDPIRS FLQFNIMQQQ PQFYSQQEDR KDFNLGGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D6e-2057124168Myocyte-specific enhancer factor 2A
3mu6_C6e-2057124168Myocyte-specific enhancer factor 2A
3mu6_B6e-2057124168Myocyte-specific enhancer factor 2A
3mu6_A6e-2057124168Myocyte-specific enhancer factor 2A
1egw_D7e-2057124168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C7e-2057124168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B7e-2057124168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A7e-2057124168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S8e-2057124269Myocyte-specific enhancer factor 2B
1tqe_R8e-2057124269Myocyte-specific enhancer factor 2B
1tqe_Q8e-2057124269Myocyte-specific enhancer factor 2B
1tqe_P8e-2057124269Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankMZEZAG1A0.0L18924.1 Corn ZAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960599.10.0PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-133MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLQ418761e-164Q41876_MAIZE; Uncharacterized protein
STRINGSb09g006360.11e-165(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-96MIKC_MADS family protein